Chromo family sequences

.

>DmPc
ddpvdlvyaaekiiqkrvkkgvveyrvkwkgwnqryntw
epevnildrrlidiyeqtnkssgtpsk
>MoMOD3
ssvgeqvfaaecilskrlrkgkleylvkwrgwsskhnsw
epeenildprlllafqkkehekevqnr
>CeYO82
madgselytvesilehrkkkgksefyikwlgydhthnsw
epkenivdptlieafftreaarkaeik
>DmHP1_A
aeeeeeeyavekiidrrvrkgkveyylkwkgypetentw
epennldcqdliqqyeasrkdeeksaa
>DvHP1_A
aeeeeeeyavekildrrvrkgkveyylkwkgyaetentw
epegnldcqdliqqyelsrkdeanaaa
>HuHP1_A
ssedeeeyvvekvldrrvvkgqveyllkwkgfseehntw
epeknldcpelisefmkkykkmkegen
>MoMOD1_A
leeeeeeyvvekvldrrvvkgkveyllkwkgfsdedntw
epeenldcpdliaeflqsqktahetdk
>MoMOD2_A
eeaepeefvvekvldrrvvngkveyflkwkgftdadntw
epeenldcpeliedflnsqkagkekdg
>PcHET1_A
sgseeeeyvvekiidkrtvngkvqyflkwkgydesentw
ephenlecpeliaeferkwekkqeekk
>PcHET2_A
vpaveeefivekildkrtepdgsvryllkwkgygdedntw
eppenmdcedlleefekklskpkkrrk
>SpSWI6_A
eeeeedeyvvekvlkhrmarkgggyeyllkwegyddpsdntw
sseadcsgckqlieaywnehggrpepsk
>CeT9A58
egksdeifevekilahkvtdnllvlqvrwlgygadedtw
epeedlqecasevvaeyykklkvtdktel
>DmSuv39
krppkgeyvveriecvemdqyqpvffvkwlgyhdsentw
eslanvadcaemekfverhqqlyetyia
>HuMG44
skrnlydfeve?lcdykkireqeyylvkwrgypdsestw
eprqnlkcvrilkqfhkdlerellrrh
>CfTENV
epeaenefevekildkkgqrylvkwkgydesentw
eprinlancyqllrqfqkwrqdsrkqea
>FoSKPY
eisgpevyeaeairdtrkingqreylikwknypenentw
eppkhlvnaqrllkdfhqrarkkerrpk
>MoCHD1_A
qpedeefetiervmdcrvgrkbbbbbbbbbbbbbbbbbbbbbbbbbbbbgdiqylikwkgwshihntw
eteetlkqqnvrgmkkldnykkkdqetkrwlk
>ScYEZ4_A
ktsleegkvlektvpdlnnckenyeflikwtdeshlhntw
etyesigqvrglkrldnyckqfiiedqqvr
>MoCHD1_B
ddlhkqyqiveriiahsnkqsaaglpdyyckwqglpysecsw
edgaliskkfqtcideyfsrnqskttpfk
>ScYEZ4_B
ldefeefhvperiidsqrasledgtsqlqylvkwrrlnydeatw
enatdivklapeqvkhfqnrenskilpqy
>MgGRH
tgepeevwaveailaaknrrgrgggrqvlvkwqgydnptw
eplelmtdtraldefearwggvhtndg
>MgMAGGY
evegereyeveeildsfwetrgrggrrlkyivrwagyseptt
epadylenaaqlvknfhrryphkpgprp
>Ce29H12
tqdsdseyeieriidhvsflebbbbbbbbbbbbbbbbbbbbbbbbbbbbbsnyfflvkwlgygnkemtw
epesnipdsvylyeykklnnmvmnrmn
>DmHP1_B
stgfdrgleaekilgasdnngrltfliqfkgvdqaemvp
ssvanekiprmvihfyeerlswysdne
>DvHP1_B
gtgfdrgleaekilgasdnngrltfliqfkgvdqaemvp
stvanvkipqmvirfyeerlswysdne
>HuHP1_B
argferglepekiigatdscgdlmflmkwkdtdeadlvl
akeanvkcpqiviafyeerltwhaype
>MoMOD1_B
prgfargleperiigatdssgelmflmkwknsdeadlvp
akeanvkcpqvvisfyeerltwhsyps
>MoMOD2_B
prgfargldperiigatdssgelmflmkwkdsdeadlvl
akeanmkcpqiviafyeerltwhscpe
>PcHET1_B
lngferglkperiigatdtsgelmflmkwegtdeadlvr
svdartkcpqliiefyekhltwnnase
>PcHET2_B
vsdfdryvpseilgvtkvggslkflmkwegieratfvl
akeanivcpqlvidyyesrlqlfdpkm
>SpSWI6_B
vkqvenydswedlvssidtierkddgtleiyltwkngaishhp
stitnkkcpqkmlqfyeshltfrene
segments of b's have been added where the original data we got contained things like <24> indicating 24 arbitrary symbols. Pratt does not look for patterns containing b's (b is not a normal amino acid symbol, but is often used as an ambiguous symbol).

Page compiled by: Inge Jonassen.

Chromo Test Set MDL.